| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 5 activator 1 |
|---|
| Ligand | BDBM59103 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Kinase Assay |
|---|
| pH | 7.2±0 |
|---|
| IC50 | 62±0 nM |
|---|
| Citation |  Wan, Y; Hur, W; Cho, CY; Liu, Y; Adrian, FJ; Lozach, O; Bach, S; Mayer, T; Fabbro, D; Meijer, L; Gray, NS Synthesis and target identification of hymenialdisine analogs. Chem Biol11:247-59 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cyclin-dependent kinase 5 activator 1 |
|---|
| Name: | Cyclin-dependent kinase 5 activator 1 |
|---|
| Synonyms: | CD5R1_HUMAN | CDK5R | CDK5R1 | Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | Cyclin-dependent kinase 5 regulatory subunit 1 | NCK5A | TPKII regulatory subunit | p35 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34077.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15078 |
|---|
| Residue: | 307 |
|---|
| Sequence: | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
|
|
|
|---|
| BDBM59103 |
|---|
| n/a |
|---|
| Name | BDBM59103 |
|---|
| Synonyms: | Hymenialdisine, 15 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H9Cl2N5O2 |
|---|
| Mol. Mass. | 314.127 |
|---|
| SMILES | NC1=NC(=O)C(N1)=C1CCNC(=O)c2[nH]c(Cl)c(Cl)c12 |w:7.8,t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
