Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 5 activator 1 |
---|
Ligand | BDBM59116 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Kinase Assay |
---|
pH | 7.2±0 |
---|
IC50 | 5110±0 nM |
---|
Citation | Wan, Y; Hur, W; Cho, CY; Liu, Y; Adrian, FJ; Lozach, O; Bach, S; Mayer, T; Fabbro, D; Meijer, L; Gray, NS Synthesis and target identification of hymenialdisine analogs. Chem Biol11:247-59 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 5 activator 1 |
---|
Name: | Cyclin-dependent kinase 5 activator 1 |
Synonyms: | CD5R1_HUMAN | CDK5R | CDK5R1 | Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | Cyclin-dependent kinase 5 regulatory subunit 1 | NCK5A | TPKII regulatory subunit | p35 |
Type: | Enzyme Subunit |
Mol. Mass.: | 34077.43 |
Organism: | Homo sapiens (Human) |
Description: | Q15078 |
Residue: | 307 |
Sequence: | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
|
|
|
BDBM59116 |
---|
n/a |
---|
Name | BDBM59116 |
Synonyms: | Hymenialdisine, 27k |
Type | Small organic molecule |
Emp. Form. | C17H14BrN5O3 |
Mol. Mass. | 416.229 |
SMILES | CC(=O)NC1=NC(=O)C(N1)=C1CCNC(=O)c2[nH]c3ccc(Br)cc3c12 |w:10.11,t:4| |
Structure |
|