Reaction Details |
| Report a problem with these data |
Target | Tubulin polymerization-promoting protein |
---|
Ligand | BDBM50005480 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Cell Proliferation Assay |
---|
IC50 | 32±21 nM |
---|
Citation | Kong, Y; Grembecka, J; Edler, MC; Hamel, E; Mooberry, SL; Sabat, M; Rieger, J; Brown, ML Structure-based discovery of a boronic acid bioisostere of combretastatin A-4. Chem Biol12:1007-14 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tubulin polymerization-promoting protein |
---|
Name: | Tubulin polymerization-promoting protein |
Synonyms: | TPPP | TPPP1 | TPPP_HUMAN | Tubulin | Tubulin polymerization-promoting protein |
Type: | Protein |
Mol. Mass.: | 23706.03 |
Organism: | Homo sapiens (Human) |
Description: | O94811 |
Residue: | 219 |
Sequence: | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAV
HGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEAL
EELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERF
DPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
|
|
|
BDBM50005480 |
---|
n/a |
---|
Name | BDBM50005480 |
Synonyms: | (-)-combretastatin | (Z)-3'-hydroxy-3,4,4',5-tetramethoxystilbene | (Z)-5-(3,4,5-trimethoxystyryl)-2-methoxyphenol | (combretastatin A-4)2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | (combretastin A-4)2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-Methoxy-5-[(Z)-2-(3,4,5-trimethox y-phenyl)-vinyl]-phenol | 2-Methoxy-5-[(Z)-2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-methoxy-5-(3,4,5-trimethoxystyryl)phenol | 2-methoxy-5-[(Z)-2-(3,4,5-trimethoxyphenyl)vinyl]phenol | 5-(3,4,5-trimethoxystyryl)-2-methoxyphenol | 5-[(S)-2-Hydroxy-2-(3,4,5-trimethoxy-phenyl)-ethyl]-2-methoxy-phenol | CHEMBL67 | Combrestatin A-4 | Combrestatin A4 | Combretastastin A-4 | Combretastatin | Combretastatin-A4 | Combretastin A-4 | Z-Combretastatin A-4 | combretastatin A-4, (CSA4) | combretastin A4 |
Type | Small organic molecule |
Emp. Form. | C18H20O5 |
Mol. Mass. | 316.3484 |
SMILES | COc1ccc(\C=C/c2cc(OC)c(OC)c(OC)c2)cc1O |
Structure |
|