new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase (VHR)
LigandBDBM32102
Substrate/Competitorn/a
Meas. Tech.uHTS absorbance assay for the identification of compounds that inhibit VHR1.
IC50 980±n/a nM
Citation PubChem PC uHTS absorbance assay for the identification of compounds that inhibit VHR1. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity protein phosphatase (VHR)
Name:Dual specificity protein phosphatase 3
Synonyms:Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR
Type:Hydrolase
Mol. Mass.:20480.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:185
Sequence:
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32102
n/a
NameBDBM32102
Synonyms:1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7(1H,6H)-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000087831 | SMR000024051 | US9284299, PKF118-310 | US9738628, Compound PKF118-310 | cid_66541
TypeSmall organic molecule
Emp. Form.C7H7N5O2
Mol. Mass.193.1628
SMILESCn1ncnc2c1nc(=O)n(C)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: