new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase (VHR)
LigandBDBM51783
Substrate/Competitorn/a
Meas. Tech.uHTS absorbance assay for the identification of compounds that inhibit VHR1.
IC50 3200±n/a nM
Citation PubChem PC uHTS absorbance assay for the identification of compounds that inhibit VHR1. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity protein phosphatase (VHR)
Name:Dual specificity protein phosphatase 3
Synonyms:Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR
Type:Hydrolase
Mol. Mass.:20480.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:185
Sequence:
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51783
n/a
NameBDBM51783
Synonyms:3-[(5E)-5-[1-(2-chlorobenzyl)-2-keto-indolin-3-ylidene]-4-keto-2-thioxo-thiazolidin-3-yl]propionic acid | 3-[(5E)-5-[1-[(2-chlorophenyl)methyl]-2-oxidanylidene-indol-3-ylidene]-4-oxidanylidene-2-sulfanylidene-1,3-thiazolidin-3-yl]propanoic acid | 3-[(5E)-5-[1-[(2-chlorophenyl)methyl]-2-oxo-3-indolylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]propanoic acid | 3-[(5E)-5-[1-[(2-chlorophenyl)methyl]-2-oxoindol-3-ylidene]-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]propanoic acid | MLS001173336 | SMR000538928 | cid_1570081
TypeSmall organic molecule
Emp. Form.C21H15ClN2O4S2
Mol. Mass.458.938
SMILESOC(=O)CCN1C(=S)S\C(C1=O)=C1\C(=O)N(Cc2ccccc2Cl)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: