new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM52077
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents
IC50 9990±n/a nM
Citation PubChem PC Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM52077
n/a
NameBDBM52077
Synonyms:3-Amino-4-piperidin-1-yl-5,6,7,7a-tetrahydro-indene-1,1,2-tricarbonitrile | 3-amino-4-(1-piperidinyl)-5,6,7,7a-tetrahydroindene-1,1,2-tricarbonitrile | 3-amino-4-piperidin-1-yl-5,6,7,7a-tetrahydroindene-1,1,2-tricarbonitrile | 3-amino-4-piperidino-5,6,7,7a-tetrahydroindene-1,1,2-tricarbonitrile | 3-azanyl-4-piperidin-1-yl-5,6,7,7a-tetrahydroindene-1,1,2-tricarbonitrile | MLS000070163 | SMR000001311 | cid_652869
TypeSmall organic molecule
Emp. Form.C17H19N5
Mol. Mass.293.3663
SMILESN=C1C(C#N)C(C#N)(C#N)C2CCCC(N3CCCCC3)=C12 |t:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: