new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM52079
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents
IC50 3990±n/a nM
Citation PubChem PC Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM52079
n/a
NameBDBM52079
Synonyms:(5,5-diketo-6H-benzo[c][1,2]benzothiazin-9-yl)amine | 5,5-bis(oxidanylidene)-6H-benzo[c][1,2]benzothiazin-9-amine | 5,5-dioxo-6H-benzo[c][1,2]benzothiazin-9-amine | 9,9-Dioxo-9,10-dihydro-9lambda*6*-thia-10-aza-phenanthren-3-ylamine | MLS000073006 | SMR000010061 | cid_653405
TypeSmall organic molecule
Emp. Form.C12H10N2O2S
Mol. Mass.246.285
SMILESNc1ccc2NS(=O)(=O)c3ccccc3-c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: