new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM60350
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents
IC50 5010±n/a nM
Citation PubChem PC Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60350
n/a
NameBDBM60350
Synonyms:3-Methyl-5-[(4-morpholin-4-yl-phenylamino)-methyl]-1-phenyl-1,7-dihydro-pyrazolo[3,4-b]pyridin-6-one | 3-methyl-5-[(4-morpholin-4-ylanilino)methyl]-1-phenyl-2H-pyrazolo[3,4-b]pyridin-6-one | 3-methyl-5-[(4-morpholinoanilino)methyl]-1-phenyl-2H-pyrazolo[3,4-b]pyridin-6-one | 3-methyl-5-[[(4-morpholin-4-ylphenyl)amino]methyl]-1-phenyl-2H-pyrazolo[3,4-b]pyridin-6-one | 3-methyl-5-[[4-(4-morpholinyl)anilino]methyl]-1-phenyl-2H-pyrazolo[3,4-b]pyridin-6-one | MLS000027200 | SMR000000917 | cid_654368
TypeSmall organic molecule
Emp. Form.C24H25N5O2
Mol. Mass.415.4876
SMILESCc1nn(-c2ccccc2)c2[nH]c(=O)c(CNc3ccc(cc3)N3CCOCC3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: