new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM60374
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents
IC50 7190±n/a nM
Citation PubChem PC Identification of SV40 T antigen inhibitors: A route to novel anti-viral reagents PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60374
n/a
NameBDBM60374
Synonyms:MLS000047422 | N-[4-(dimethylamino)phenyl]-2-[4-(2-fluorophenyl)-1-piperazinyl]acetamide | N-[4-(dimethylamino)phenyl]-2-[4-(2-fluorophenyl)piperazin-1-yl]acetamide | N-[4-(dimethylamino)phenyl]-2-[4-(2-fluorophenyl)piperazin-1-yl]ethanamide | N-[4-(dimethylamino)phenyl]-2-[4-(2-fluorophenyl)piperazino]acetamide | SMR000033433 | cid_3235936
TypeSmall organic molecule
Emp. Form.C20H25FN4O
Mol. Mass.356.4371
SMILESCN(C)c1ccc(NC(=O)CN2CCN(CC2)c2ccccc2F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: