new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 35
LigandBDBM61153
Substrate/Competitorn/a
Meas. Tech.Image-Based HTS for Selective Antagonists of GPR35
IC50 500±n/a nM
Citation PubChem PC Image-Based HTS for Selective Antagonists of GPR35 PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 35
Name:G-protein coupled receptor 35
Synonyms:G protein-coupled receptor 35
Type:Enzyme Catalytic Domain
Mol. Mass.:34085.57
Organism:Homo sapiens (Human)
Description:gi_33695097
Residue:309
Sequence:
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM61153
n/a
NameBDBM61153
Synonyms:3-[4-[(5Z)-4-keto-5-(4-methylbenzylidene)-2-thioxo-thiazolidin-3-yl]butanoylamino]benzoic acid | 3-[4-[(5Z)-5-[(4-methylphenyl)methylidene]-4-oxidanylidene-2-sulfanylidene-1,3-thiazolidin-3-yl]butanoylamino]benzoic acid | 3-[4-[(5Z)-5-[(4-methylphenyl)methylidene]-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]butanoylamino]benzoic acid | 3-[[4-[(5Z)-5-[(4-methylphenyl)methylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]-1-oxobutyl]amino]benzoic acid | MLS001034563 | SMR000664707 | cid_1346721
TypeSmall organic molecule
Emp. Form.C22H20N2O4S2
Mol. Mass.440.535
SMILESCc1ccc(\C=C2/SC(=S)N(CCCC(=O)Nc3cccc(c3)C(O)=O)C2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: