Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 4 |
---|
Ligand | BDBM47735 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds |
---|
EC50 | 30000±n/a nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 4 |
---|
Name: | Regulator of G-protein signaling 4 |
Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
Type: | Enzyme |
Mol. Mass.: | 23263.51 |
Organism: | Homo sapiens (Human) |
Description: | P49798 |
Residue: | 205 |
Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
BDBM47735 |
---|
n/a |
---|
Name | BDBM47735 |
Synonyms: | 3-chloranyl-N-(3,3-dimethylbutan-2-yl)-6-nitro-1-benzothiophene-2-carboxamide | 3-chloro-6-nitro-N-(1,2,2-trimethylpropyl)-1-benzothiophene-2-carboxamide | 3-chloro-6-nitro-N-(1,2,2-trimethylpropyl)benzothiophene-2-carboxamide | 3-chloro-N-(3,3-dimethylbutan-2-yl)-6-nitro-1-benzothiophene-2-carboxamide | MLS000583265 | SMR000201101 | cid_2971539 |
Type | Small organic molecule |
Emp. Form. | C15H17ClN2O3S |
Mol. Mass. | 340.825 |
SMILES | CC(NC(=O)c1sc2cc(ccc2c1Cl)[N+]([O-])=O)C(C)(C)C |
Structure |
|