new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetregulator of G-protein signaling 4
LigandBDBM47719
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds
Ki 260±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
regulator of G-protein signaling 4
Name:Regulator of G-protein signaling 4 (RGS4)
Synonyms:RGP4 | RGS4
Type:Enzyme
Mol. Mass.:23263.51
Organism:Homo sapiens (Human)
Description:P49798
Residue:205
Sequence:
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47719
n/a
NameBDBM47719
Synonyms:(4-chlorodithiazol-5-ylidene)-(4-chloro-2-methyl-phenyl)amine | 4-chloranyl-N-(4-chloranyl-2-methyl-phenyl)-1,2,3-dithiazol-5-imine | 4-chloro-N-(4-chloro-2-methylphenyl)-5-dithiazolimine | 4-chloro-N-(4-chloro-2-methylphenyl)dithiazol-5-imine | 4-chloro-N-(4-chloro-5H-1,2,3-dithiazol-5-yliden)-2-methylaniline | MLS000539990 | SMR000125448 | cid_1471255
TypeSmall organic molecule
Emp. Form.C9H6Cl2N2S2
Mol. Mass.277.193
SMILESCc1cc(Cl)ccc1\N=c1\ssnc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: