new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetregulator of G-protein signaling 4
LigandBDBM32274
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds
Ki 290±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
regulator of G-protein signaling 4
Name:Regulator of G-protein signaling 4 (RGS4)
Synonyms:RGP4 | RGS4
Type:Enzyme
Mol. Mass.:23263.51
Organism:Homo sapiens (Human)
Description:P49798
Residue:205
Sequence:
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32274
n/a
NameBDBM32274
Synonyms:2,5-bis(chloranyl)-3-(4-methylpiperazin-1-yl)-6-(2-piperidin-1-yl-1,3-thiazol-5-yl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(4-methyl-1-piperazinyl)-6-[2-(1-piperidinyl)-1,3-thiazol-5-yl]benzo-1,4-quinone | 2,5-dichloro-3-(4-methyl-1-piperazinyl)-6-[2-(1-piperidinyl)-5-thiazolyl]cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(4-methylpiperazin-1-yl)-6-(2-piperidin-1-yl-1,3-thiazol-5-yl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(4-methylpiperazino)-6-(2-piperidinothiazol-5-yl)-p-benzoquinone | MLS000548207 | SMR000115103 | cid_1002249
TypeSmall organic molecule
Emp. Form.C19H22Cl2N4O2S
Mol. Mass.441.375
SMILESCN1CCN(CC1)C1=C(Cl)C(=O)C(c2cnc(s2)N2CCCCC2)=C(Cl)C1=O |c:8,t:26|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: