Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 4 |
---|
Ligand | BDBM46590 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds |
---|
Ki | 1020±n/a nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 4 |
---|
Name: | Regulator of G-protein signaling 4 |
Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
Type: | Enzyme |
Mol. Mass.: | 23263.51 |
Organism: | Homo sapiens (Human) |
Description: | P49798 |
Residue: | 205 |
Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
BDBM46590 |
---|
n/a |
---|
Name | BDBM46590 |
Synonyms: | 4-[2-[(E)-(2,3-dihydroxy-4-oxocyclohexa-2,5-dien-1-ylidene)methyl]hydrazinyl]-3-nitrobenzenesulfonamide | 4-[2-[(E)-[2,3-bis(oxidanyl)-4-oxidanylidene-cyclohexa-2,5-dien-1-ylidene]methyl]hydrazinyl]-3-nitro-benzenesulfonamide | 4-[N'-[(E)-(2,3-dihydroxy-4-keto-cyclohexa-2,5-dien-1-ylidene)methyl]hydrazino]-3-nitro-benzenesulfonamide | 4-[[(E)-(2,3-dihydroxy-4-oxo-1-cyclohexa-2,5-dienylidene)methyl]hydrazo]-3-nitrobenzenesulfonamide | MLS000759826 | SMR000369866 | cid_5982653 |
Type | Small organic molecule |
Emp. Form. | C13H12N4O7S |
Mol. Mass. | 368.322 |
SMILES | NS(=O)(=O)c1ccc(N=[NH+]Cc2ccc([O-])c(O)c2O)c(c1)[N+]([O-])=O |w:8.7| |
Structure |
|