new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRGS7
LigandBDBM47764
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao for SAR Compounds
Ki 1870±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao for SAR Compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RGS7
Name:RGS7
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57675.72
Organism:Homo sapiens (Human)
Description:P49802
Residue:495
Sequence:
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47764
n/a
NameBDBM47764
Synonyms:(4E)-5-methyl-4-[[3-[[(Z)-(3-methyl-1-phenyl-5-sulfanylidene-4-pyrazolylidene)methyl]amino]propylamino]methylidene]-2-phenyl-3-pyrazolethione | (4E)-5-methyl-4-[[3-[[(Z)-(3-methyl-1-phenyl-5-sulfanylidene-pyrazol-4-ylidene)methyl]amino]propylamino]methylidene]-2-phenyl-pyrazole-3-thione | (4E)-5-methyl-4-[[3-[[(Z)-(3-methyl-1-phenyl-5-sulfanylidenepyrazol-4-ylidene)methyl]amino]propylamino]methylidene]-2-phenylpyrazole-3-thione | (4E)-5-methyl-4-[[3-[[(Z)-(3-methyl-1-phenyl-5-thioxo-2-pyrazolin-4-ylidene)methyl]amino]propylamino]methylene]-2-phenyl-2-pyrazoline-3-thione | 3-methyl-4-{[(3-{[(3-methyl-1-phenyl-5-sulfanyl-1H-pyrazol-4-yl)methylene]amino}propyl)imino]methyl}-1-phenyl-1H-pyrazole-5-thiol | MLS000701800 | SMR000225437 | cid_5581000
TypeSmall organic molecule
Emp. Form.C25H26N6S2
Mol. Mass.474.644
SMILESCc1[nH]n(-c2ccccc2)c(=S)c1C=NCCCN=Cc1c(C)[nH]n(-c2ccccc2)c1=S |w:14.16,18.19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: