new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRGS7
LigandBDBM47798
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao for SAR Compounds
Ki 230±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao for SAR Compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RGS7
Name:RGS7
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57675.72
Organism:Homo sapiens (Human)
Description:P49802
Residue:495
Sequence:
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47798
n/a
NameBDBM47798
Synonyms:4-chloranyl-6-(4,6-dimethylpyrimidin-2-yl)sulfanyl-N-methyl-1,3,5-triazin-2-amine | 4-chloro-6-(4,6-dimethylpyrimidin-2-yl)sulfanyl-N-methyl-1,3,5-triazin-2-amine | 4-chloro-6-[(4,6-dimethyl-2-pyrimidinyl)thio]-N-methyl-1,3,5-triazin-2-amine | MLS000707335 | SMR000288800 | [4-chloro-6-[(4,6-dimethylpyrimidin-2-yl)thio]-s-triazin-2-yl]-methyl-amine | cid_1087037
TypeSmall organic molecule
Emp. Form.C10H11ClN6S
Mol. Mass.282.753
SMILESCNc1nc(Cl)nc(Sc2nc(C)cc(C)n2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: