Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 16 |
---|
Ligand | BDBM34972 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao for SAR Compounds |
---|
EC50 | 822±78.37 nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao for SAR Compounds PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 16 |
---|
Name: | Regulator of G-protein signaling 16 |
Synonyms: | RGS16 | RGS16_HUMAN | RGSR | Regulator of G-protein signaling 16 (RGS16) | regulator of G-protein signalling 16 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 22748.87 |
Organism: | Homo sapiens (Human) |
Description: | gi_156416009 |
Residue: | 202 |
Sequence: | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
|
|
|
BDBM34972 |
---|
n/a |
---|
Name | BDBM34972 |
Synonyms: | MLS000759648 | N''-[(E)-(2,3-dihydroxy-4-oxo-1-cyclohexa-2,5-dienylidene)methyl]-2-[2-(4-morpholinyl)-4-thiazolyl]acetohydrazide | N''-[(E)-(2,3-dihydroxy-4-oxocyclohexa-2,5-dien-1-ylidene)methyl]-2-(2-morpholin-4-yl-1,3-thiazol-4-yl)acetohydrazide | N''-[(E)-[2,3-bis(oxidanyl)-4-oxidanylidene-cyclohexa-2,5-dien-1-ylidene]methyl]-2-(2-morpholin-4-yl-1,3-thiazol-4-yl)ethanehydrazide | N''-[(Z)-(2,3-dihydroxy-4-keto-cyclohexa-2,5-dien-1-ylidene)methyl]-2-(2-morpholinothiazol-4-yl)acetohydrazide | N'-[(E)-(2,3-dihydroxy-4-keto-cyclohexa-2,5-dien-1-ylidene)methyl]-2-(2-morpholinothiazol-4-yl)acetohydrazide | N'-[(Z)-(2,3-dihydroxy-4-keto-cyclohexa-2,5-dien-1-ylidene)methyl]-2-(2-morpholinothiazol-4-yl)acetohydrazide | SMR000369439 | cid_6508305 |
Type | Small organic molecule |
Emp. Form. | C16H18N4O5S |
Mol. Mass. | 378.403 |
SMILES | Oc1ccc(C=NNC(=O)Cc2csc(n2)N2CCOCC2)c(O)c1O |w:6.6| |
Structure |
|