Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 16 |
---|
Ligand | BDBM34435 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao for SAR Compounds |
---|
Ki | 580±n/a nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao for SAR Compounds PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 16 |
---|
Name: | Regulator of G-protein signaling 16 |
Synonyms: | RGS16 | RGS16_HUMAN | RGSR | Regulator of G-protein signaling 16 (RGS16) | regulator of G-protein signalling 16 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 22748.87 |
Organism: | Homo sapiens (Human) |
Description: | gi_156416009 |
Residue: | 202 |
Sequence: | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
|
|
|
BDBM34435 |
---|
n/a |
---|
Name | BDBM34435 |
Synonyms: | 4-cyano-3-methyl-5-[[1-oxo-2-[[5-(phenylmethyl)-1,3,4-oxadiazol-2-yl]thio]ethyl]amino]-2-thiophenecarboxylic acid ethyl ester | 5-[[2-[(5-benzyl-1,3,4-oxadiazol-2-yl)thio]acetyl]amino]-4-cyano-3-methyl-thiophene-2-carboxylic acid ethyl ester | MLS000051364 | SMR000079493 | cid_2222655 | ethyl 4-cyano-3-methyl-5-[2-[[5-(phenylmethyl)-1,3,4-oxadiazol-2-yl]sulfanyl]ethanoylamino]thiophene-2-carboxylate | ethyl 5-({[(5-benzyl-1,3,4-oxadiazol-2-yl)thio]acetyl}amino)-4-cyano-3-methyl-2-thiophenecarboxylate | ethyl 5-[[2-[(5-benzyl-1,3,4-oxadiazol-2-yl)sulfanyl]acetyl]amino]-4-cyano-3-methylthiophene-2-carboxylate |
Type | Small organic molecule |
Emp. Form. | C20H18N4O4S2 |
Mol. Mass. | 442.511 |
SMILES | CCOC(=O)c1sc(NC(=O)CSc2nnc(Cc3ccccc3)o2)c(C#N)c1C |
Structure |
|