new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 8
LigandBDBM34524
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds
EC50 550±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Regulator of G-protein signaling 8
Name:Regulator of G-protein signaling 8
Synonyms:Regulator of G-protein signaling 8 (RGS8)
Type:Enzyme Catalytic Domain
Mol. Mass.:20925.80
Organism:Homo sapiens (Human)
Description:gi_74355113
Residue:180
Sequence:
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34524
n/a
NameBDBM34524
Synonyms:2-[2-keto-2-[3-methyl-4-(m-tolyl)piperazino]ethyl]-4,6-dimethyl-isothiazolo[5,4-b]pyridin-3-one | 4,6-dimethyl-2-[2-[3-methyl-4-(3-methylphenyl)-1-piperazinyl]-2-oxoethyl]-3-isothiazolo[5,4-b]pyridinone | 4,6-dimethyl-2-[2-[3-methyl-4-(3-methylphenyl)piperazin-1-yl]-2-oxidanylidene-ethyl]-[1,2]thiazolo[5,4-b]pyridin-3-one | 4,6-dimethyl-2-[2-[3-methyl-4-(3-methylphenyl)piperazin-1-yl]-2-oxoethyl]-[1,2]thiazolo[5,4-b]pyridin-3-one | MLS000118900 | SMR000095840 | cid_5309798
TypeSmall organic molecule
Emp. Form.C22H26N4O2S
Mol. Mass.410.532
SMILESCC1CN(CCN1c1cccc(C)c1)C(=O)Cn1sc2nc(C)cc(C)c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: