BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 8
LigandBDBM43363
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds
Ki 60±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Regulator of G-protein signaling 8
Name:Regulator of G-protein signaling 8
Synonyms:Regulator of G-protein signaling 8 (RGS8)
Type:Enzyme Catalytic Domain
Mol. Mass.:20925.80
Organism:Homo sapiens (Human)
Description:gi_74355113
Residue:180
Sequence:
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43363
n/a
NameBDBM43363
Synonyms:2,5-bis(chloranyl)-3-piperidin-1-yl-6-(2-piperidin-1-yl-1,3-thiazol-5-yl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(1-piperidinyl)-6-[2-(1-piperidinyl)-1,3-thiazol-5-yl]benzo-1,4-quinone | 2,5-dichloro-3-(1-piperidinyl)-6-[2-(1-piperidinyl)-5-thiazolyl]cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-piperidin-1-yl-6-(2-piperidin-1-yl-1,3-thiazol-5-yl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-piperidino-6-(2-piperidinothiazol-5-yl)-p-benzoquinone | MLS000550549 | SMR000115104 | cid_406171
TypeSmall organic molecule
Emp. Form.C19H21Cl2N3O2S
Mol. Mass.426.36
SMILESClC1=C(N2CCCCC2)C(=O)C(Cl)=C(c2cnc(s2)N2CCCCC2)C1=O |c:1,t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: