BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 8
LigandBDBM33145
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds
Ki 340±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao for SAR Compounds PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Regulator of G-protein signaling 8
Name:Regulator of G-protein signaling 8
Synonyms:Regulator of G-protein signaling 8 (RGS8)
Type:Enzyme Catalytic Domain
Mol. Mass.:20925.80
Organism:Homo sapiens (Human)
Description:gi_74355113
Residue:180
Sequence:
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33145
n/a
NameBDBM33145
Synonyms:3-[[[(E)-(2,3-dihydroxy-4-keto-cyclohexa-2,5-dien-1-ylidene)methyl]amino]carbamoyl]-N,N-diethyl-benzenesulfonamide | 3-[[[(E)-(2,3-dihydroxy-4-oxo-1-cyclohexa-2,5-dienylidene)methyl]hydrazo]-oxomethyl]-N,N-diethylbenzenesulfonamide | 3-[[[(E)-(2,3-dihydroxy-4-oxocyclohexa-2,5-dien-1-ylidene)methyl]amino]carbamoyl]-N,N-diethylbenzenesulfonamide | 3-[[[(E)-[2,3-bis(oxidanyl)-4-oxidanylidene-cyclohexa-2,5-dien-1-ylidene]methyl]amino]carbamoyl]-N,N-diethyl-benzenesulfonamide | 3-[[[(Z)-(2,3-dihydroxy-4-keto-cyclohexa-2,5-dien-1-ylidene)methyl]amino]carbamoyl]-N,N-diethyl-benzenesulfonamide | MLS000336733 | SMR000244048 | cid_6263555
TypeSmall organic molecule
Emp. Form.C18H21N3O6S
Mol. Mass.407.441
SMILESCCN(CC)S(=O)(=O)c1cccc(c1)C(=O)NN=Cc1ccc(O)c(O)c1O |w:17.17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: