Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 19 |
---|
Ligand | BDBM47770 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao for SAR Compounds |
---|
EC50 | 245±n/a nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao for SAR Compounds PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 19 |
---|
Name: | Regulator of G-protein signaling 19 |
Synonyms: | G protein signalling regulator 19 | GAIP | GNAI3IP | RGS19 | RGS19_HUMAN | Regulator of G-protein signaling 19 (RGS19) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 24631.38 |
Organism: | Homo sapiens (Human) |
Description: | gi_86990435 |
Residue: | 217 |
Sequence: | MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQ
ASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
|
|
|
BDBM47770 |
---|
n/a |
---|
Name | BDBM47770 |
Synonyms: | 4-[5-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-ylidene)methyl]-2-furanyl]benzenesulfonamide | 4-[5-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-ylidene)methyl]furan-2-yl]benzenesulfonamide | 4-[5-[(4,6-diketo-2,2-dimethyl-1,3-dioxan-5-ylidene)methyl]-2-furyl]benzenesulfonamide | 4-[5-[[2,2-dimethyl-4,6-bis(oxidanylidene)-1,3-dioxan-5-ylidene]methyl]furan-2-yl]benzenesulfonamide | MLS000703574 | SMR000273939 | cid_1154580 |
Type | Small organic molecule |
Emp. Form. | C17H15NO7S |
Mol. Mass. | 377.369 |
SMILES | [#6]C1([#6])[#8]-[#6](=O)\[#6](=[#6]/c2ccc(o2)-c2ccc(cc2)S([#7])(=O)=O)-[#6](=O)-[#8]1 |
Structure |
|