new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetheat shock protein 90
LigandBDBM38924
Substrate/Competitorn/a
Meas. Tech.Fluorescence Cell-Based Secondary Assay to Identify Inhibitors of Resistant C. albicans Growth in the Presence of Fluconazole
EC50 521±1296 nM
Citation PubChem PC Fluorescence Cell-Based Secondary Assay to Identify Inhibitors of Resistant C. albicans Growth in the Presence of Fluconazole PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
heat shock protein 90
Name:heat shock protein 90
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:80784.12
Organism:Candida albicans
Description:gi_994798
Residue:707
Sequence:
MADAKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPSQLE
SEPELFIRIIPQKDQKVLEIRDSGIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMI
GQFGVGFYSLFLVADHVQVISKHNDDEQYVWESNAGGKFTVTLDETNERLGRGTMLRLFL
KEDQLEYLEEKRIKEVVKKHSEFVAYPIQLVVTKEVEKEVPETEEEDKAAEEDDKKPKLE
EVKDEEDEKKEKKTKTVKEEVTETEELNKTKPLWTRNPSDITQDEYNAFYKSISNDWEDP
LAVKHFSVEGQLEFRAILFVPKRAPFDAFESKKKKNNIKLYVRRVFITDDAEELIPEWLS
FIKGVVDSEDLPLNLSREMLQQNKILKVIRKNIVKKMIETFNEISEDQEQFNQFYTAFSK
NIKLGIHEDAQNRQSLAKLLRFYSTKSSEEMTSLSDYVTRMPEHQKNIYYITGESIKAVE
KSPFLDALKAKNFEVLFMVDPIDEYAMTQLKEFEDKKLVDITKDFELEESDEEKAAREKE
IKEYEPLTKALKDILGDQVEKVVVSYKLVDAPAAIRTGQFGWSANMERIMKAQALRDTTM
SSYMSSKKTFEISPSSPIIKELKKKVETDGAEDKTVKDLTTLLFDTALLTSGFTLDEPSN
FAHRINRLIALGLNIDDDSEETAVEPEATTTASTDEPAGESAMEEVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38924
n/a
NameBDBM38924
Synonyms:2,6-bis(2-pyridinyl)pyridine | 2,6-bis(2-pyridyl)pyridine | 2,6-dipyridin-2-ylpyridine | MLS000048666 | SMR000060049 | cid_70848
TypeSmall organic molecule
Emp. Form.C15H11N3
Mol. Mass.233.2679
SMILESc1ccc(nc1)-c1cccc(n1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: