new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRPL19A
LigandBDBM37061
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically RPL19A based on MLPCN hits
EC50 3822±n/a nM
Citation PubChem PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically RPL19A based on MLPCN hits PubChem Bioassay (2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RPL19A
Name:RPL19A
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:21739.62
Organism:Saccharomyces cerevisiae
Description:gi_536029
Residue:189
Sequence:
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM37061
n/a
NameBDBM37061
Synonyms:(4-methoxy-1,3-benzothiazol-2-yl)-[4-(2-pyridyl)thiazol-2-yl]amine | 4-methoxy-N-(4-pyridin-2-yl-1,3-thiazol-2-yl)-1,3-benzothiazol-2-amine | 4-methoxy-N-[4-(2-pyridinyl)-2-thiazolyl]-1,3-benzothiazol-2-amine | MLS000045456 | SMR000027216 | cid_3240629
TypeSmall organic molecule
Emp. Form.C16H12N4OS2
Mol. Mass.340.423
SMILESCOc1cccc2sc(Nc3nc(cs3)-c3ccccn3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: