| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 60S ribosomal protein L19-A |
|---|
| Ligand | BDBM65989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically RPL19A based on MLPCN hits |
|---|
| EC50 | 12940±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically RPL19A based on MLPCN hits PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 60S ribosomal protein L19-A |
|---|
| Name: | 60S ribosomal protein L19-A |
|---|
| Synonyms: | RL19A_YEAST | RPL19A | RPL23A | YL14A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21739.62 |
|---|
| Organism: | Saccharomyces cerevisiae |
|---|
| Description: | gi_536029 |
|---|
| Residue: | 189 |
|---|
| Sequence: | MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
|
|
|
|---|
| BDBM65989 |
|---|
| n/a |
|---|
| Name | BDBM65989 |
|---|
| Synonyms: | 2-thiophenecarboxylic acid [(Z)-[1-amino-2-(2,4-dichlorophenyl)ethylidene]amino] ester | MLS000563358 | SMR000176881 | [(Z)-[1-amino-2-(2,4-dichlorophenyl)ethylidene]amino] thiophene-2-carboxylate | [(Z)-[1-azanyl-2-(2,4-dichlorophenyl)ethylidene]amino] thiophene-2-carboxylate | cid_9594345 | thiophene-2-carboxylic acid [(Z)-[1-amino-2-(2,4-dichlorophenyl)ethylidene]amino] ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H10Cl2N2O2S |
|---|
| Mol. Mass. | 329.202 |
|---|
| SMILES | Clc1ccc(CC(=N)NOC(=O)c2cccs2)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
