| Reaction Details |
|---|
 | Report a problem with these data |
| Target | S-ribosylhomocysteine lyase |
|---|
| Ligand | BDBM65978 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence Cell-Free Homogeneous Dose Response to Identify Inhibitors of Lux-S |
|---|
| EC50 | >350000±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence Cell-Free Homogeneous Dose Response to Identify Inhibitors of Lux-S PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| S-ribosylhomocysteine lyase |
|---|
| Name: | S-ribosylhomocysteine lyase |
|---|
| Synonyms: | LuxS |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15564.06 |
|---|
| Organism: | Vibrio harveyi |
|---|
| Description: | B0LUE4 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY
AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI
PELNEYQCGTAAMHSLDEAK
|
|
|
|---|
| BDBM65978 |
|---|
| n/a |
|---|
| Name | BDBM65978 |
|---|
| Synonyms: | MLS000690454 | N-[({4-[(dimethylamino)sulfonyl]phenyl}amino)carbonothioyl]-2-phenylacetamide | N-[[4-(dimethylsulfamoyl)anilino]-sulfanylidenemethyl]-2-phenylacetamide | N-[[4-(dimethylsulfamoyl)phenyl]carbamothioyl]-2-phenyl-ethanamide | N-[[4-(dimethylsulfamoyl)phenyl]carbamothioyl]-2-phenylacetamide | N-[[4-(dimethylsulfamoyl)phenyl]thiocarbamoyl]-2-phenyl-acetamide | SMR000300303 | cid_2214684 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H19N3O3S2 |
|---|
| Mol. Mass. | 377.481 |
|---|
| SMILES | CN(C)S(=O)(=O)c1ccc(NC(=S)NC(=O)Cc2ccccc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
