BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKruppel-like factor 5
LigandBDBM34853
Substrate/Competitorn/a
Meas. Tech.Late stage results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): luminescence-based cell-based dose response assay for inhibitors of KLF5 (Round 1)
IC50>39841±n/a nM
Citation PubChem PC Late stage results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): luminescence-based cell-based dose response assay for inhibitors of KLF5 (Round 1) PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Kruppel-like factor 5
Name:Kruppel-like factor 5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:50808.71
Organism:Homo sapiens (Human)
Description:Q13887
Residue:457
Sequence:
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34853
n/a
NameBDBM34853
Synonyms:(6-chloro-2-phenyl-benzotriazol-5-yl)amine | 6-chloranyl-2-phenyl-benzotriazol-5-amine | 6-chloro-2-phenyl-5-benzotriazolamine | 6-chloro-2-phenylbenzotriazol-5-amine | MLS000706165 | SMR000288217 | cid_736374
TypeSmall organic molecule
Emp. Form.C12H9ClN4
Mol. Mass.244.68
SMILESNc1cc2nn(nc2cc1Cl)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: