Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein Kinase C
LigandBDBM2596
Substrate/CompetitorLysine-rich histone
Meas. Tech.PKC assay
pH7.5±n/a
Temperature303.15±n/a K
IC50 3000±600 nM
Citation Davis PDHill CHLawton GNixon JSWilkinson SEHurst SAKeech ETurner SE Inhibitors of protein kinase C. 1. 2,3-Bisarylmaleimides. J Med Chem 35:177-84 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Protein Kinase C
Name:Protein kinase C (PKC)
Synonyms:PKC, rat brain | Protein kinase C beta
Type:Enzyme Mixture
Mol. Mass.:76755.54
Organism:Rattus norvegicus (rat)
Description:PKC from rat brain is known to contain predominately the conventional PKC isoforms, alpha, beta I, beta II, gamma.
Residue:671
Sequence:
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2596
Lysine-rich histone
Name:Lysine-rich histone
Synonyms:ING Peptide | Lys-rich histone | histone type IIIS
Type:Peptide
Mol. Mass.:10508.21
Organism:Bos taurus (bovine)
Description:Purified as a lysine rich fraction of histone H1 from calf thymus.
Residue:105
Sequence:
SETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLAA
LKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: