new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM74456
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2
IC50>79400±0 nM
Citation PubChem PC Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM74456
n/a
NameBDBM74456
Synonyms:5-methyl-N-[3-(2-oxidanylidenepyrrolidin-1-yl)propyl]thiophene-3-carboxamide | 5-methyl-N-[3-(2-oxo-1-pyrrolidinyl)propyl]-3-thiophenecarboxamide | 5-methyl-N-[3-(2-oxopyrrolidin-1-yl)propyl]thiophene-3-carboxamide | MLS000065817 | N-[3-(2-ketopyrrolidino)propyl]-5-methyl-thiophene-3-carboxamide | SMR000080506 | cid_2225281
TypeSmall organic molecule
Emp. Form.C13H18N2O2S
Mol. Mass.266.359
SMILESCc1cc(cs1)C(=O)NCCCN1CCCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: