Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM34452 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | SAR analysis of compounds that inhibit VHR1, Fluorescent Assay - Set 2 |
---|
IC50 | >100000±n/a nM |
---|
Citation | PubChem, PC SAR analysis of compounds that inhibit VHR1, Fluorescent Assay - Set 2 PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM34452 |
---|
n/a |
---|
Name | BDBM34452 |
Synonyms: | (4-amino-3-phenyl-2-sulfanylidene-1,3-thiazol-5-yl)-(4-methylpiperazin-1-yl)methanone | (4-amino-3-phenyl-2-sulfanylidene-5-thiazolyl)-(4-methyl-1-piperazinyl)methanone | (4-amino-3-phenyl-2-thioxo-4-thiazolin-5-yl)-(4-methylpiperazino)methanone | (4-azanyl-3-phenyl-2-sulfanylidene-1,3-thiazol-5-yl)-(4-methylpiperazin-1-yl)methanone | 4-amino-5-[(4-methyl-1-piperazinyl)carbonyl]-3-phenyl-1,3-thiazole-2(3H)-thione | MLS000088091 | SMR000072313 | cid_889170 |
Type | Small organic molecule |
Emp. Form. | C15H18N4OS2 |
Mol. Mass. | 334.46 |
SMILES | CN1CCN(CC1)C(=O)c1sc(=S)n(c1N)-c1ccccc1 |
Structure |
|