new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntestinal alkaline phosphatase
LigandBDBM50538
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS hits from a small molecule inhibitors of human intestinal alkaline phosphatase via a luminescent assay
IC50 3520±n/a nM
Citation PubChem PC Dose Response confirmation of uHTS hits from a small molecule inhibitors of human intestinal alkaline phosphatase via a luminescent assay PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Intestinal alkaline phosphatase
Name:Intestinal alkaline phosphatase
Synonyms:Alkaline phosphatase, intestinal
Type:PROTEIN
Mol. Mass.:56804.94
Organism:Homo sapiens (Human)
Description:ChEMBL_1278525
Residue:528
Sequence:
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50538
n/a
NameBDBM50538
Synonyms:8,9-bis(oxidanyl)-[1]benzofuro[3,2-c]chromen-6-one | 8,9-dihydroxy-6-benzofuro[3,2-c][1]benzopyranone | 8,9-dihydroxy-6H-[1]benzofuro[3,2-c]chromen-6-one | 8,9-dihydroxy-[1]benzofuro[3,2-c]chromen-6-one | 8,9-dihydroxybenzofuro[3,2-c]chromen-6-one | MLS000689780 | SMR000313384 | cid_638310
TypeSmall organic molecule
Emp. Form.C15H8O5
Mol. Mass.268.221
SMILESOc1cc2oc3c(c2cc1O)c(=O)oc1ccccc31
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: