BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKruppel-like factor 5
LigandBDBM76096
Substrate/Competitorn/a
Meas. Tech.Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5)
IC50 2246±n/a nM
Citation PubChem PC Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Kruppel-like factor 5
Name:Kruppel-like factor 5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:50808.71
Organism:Homo sapiens (Human)
Description:Q13887
Residue:457
Sequence:
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM76096
n/a
NameBDBM76096
Synonyms:(E)-3-(3-nitrophenyl)-2-propenoic acid [2-[(1,1-dioxo-3-thiolanyl)-methylamino]-2-oxoethyl] ester | (E)-3-(3-nitrophenyl)acrylic acid [2-[(1,1-diketothiolan-3-yl)-methyl-amino]-2-keto-ethyl] ester | SR-01000765880 | SR-01000765880-2 | [2-[(1,1-dioxothiolan-3-yl)-methylamino]-2-oxoethyl] (E)-3-(3-nitrophenyl)prop-2-enoate | [2-[[1,1-bis(oxidanylidene)thiolan-3-yl]-methyl-amino]-2-oxidanylidene-ethyl] (E)-3-(3-nitrophenyl)prop-2-enoate | cid_5951923
TypeSmall organic molecule
Emp. Form.C16H18N2O7S
Mol. Mass.382.388
SMILESCN(C1CCS(=O)(=O)C1)C(=O)COC(=O)\C=C\c1cccc(c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: