new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntestinal alkaline phosphatase
LigandBDBM75772
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS hits from a small molecule inhibitors of human intestinal alkaline phosphatase via a luminescent assay - Set 2
IC50 565±n/a nM
Citation PubChem PC Dose Response confirmation of uHTS hits from a small molecule inhibitors of human intestinal alkaline phosphatase via a luminescent assay - Set 2 PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Intestinal alkaline phosphatase
Name:Intestinal alkaline phosphatase
Synonyms:Alkaline phosphatase, intestinal
Type:PROTEIN
Mol. Mass.:56804.94
Organism:Homo sapiens (Human)
Description:ChEMBL_1278525
Residue:528
Sequence:
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75772
n/a
NameBDBM75772
Synonyms:3-(3,4-dihydroxyphenyl)-6,8-dihydroxy-2-benzopyran-1-one | 3-(3,4-dihydroxyphenyl)-6,8-dihydroxy-isocoumarin | 3-(3,4-dihydroxyphenyl)-6,8-dihydroxyisochromen-1-one | 3-[3,4-bis(oxidanyl)phenyl]-6,8-bis(oxidanyl)isochromen-1-one | MLS002473235 | SMR001397322 | cid_5473310 | thungerginol B
TypeSmall organic molecule
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1cc(O)c2c(c1)cc(oc2=O)-c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: