Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphorylase Kinase
LigandBDBM2682
Substrate/CompetitorPhosphorylase b
Meas. Tech.Phosphorylase Kinasse Assay
pH7±n/a
Temperature303.15±n/a K
IC50 1800±300 nM
Citation Toullec DPianetti PCoste HBellevergue PGrand-Perret TAjakane MBaudet VBoissin PBoursier ELoriolle F The bisindolylmaleimide GF 109203X is a potent and selective inhibitor of protein kinase C. J Biol Chem 266:15771-81 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Phosphorylase Kinase
Name:Phosphorylase Kinase
Synonyms:n/a
Type:Enzyme Complex
Mol. Mass.:138403.25
Organism:Oryctolagus cuniculus (rabbit)
Description:The enzyme is a hexadecamer of four types of subunits:alpha(4)beta(4)gamma(4)delta(4) isolated from skeletal muscle of rabbits.
Residue:1237
Sequence:
MRSRSNSGVRLDSYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVISFPAFAVEDSKLVEITKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYREALEAVLI
KGKNGVPLLPELYSVPPDKVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKAILKDKGINVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISQTMLDEDGTSLNSSILAALRKMQDGYFGGARIQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDELESGDWMDGYNSTSTARCGDEV
ARYLDHLLAHTAPHPKLAPASQKGGLNRFRAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSLNLLDSSHPSQEDQVPTVRVEVHLPRDQSGEVDFQALVLQLKETSSLQEQA
DILYMLYTMKGPDWDTELYEEGSATVRELLTELYGKVGKIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTRLIEEACEGDMNISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
TESQPNGGHSLGADLMSPSFLSPGTSVTPSSGSFPGHHTSKDSRQGQWQRRRRLDGALNR
VPIGFYQKVWKVLQKCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQL
LVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDIMLAKDPASGICT
LLYDSAPSGRFGTMTYLSKAAATYVQEFLPHSICAMQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2682
Phosphorylase b
Name:Phosphorylase b
Synonyms:n/a
Type:Peptide
Mol. Mass.:1157.29
Organism:n/a
Description:250 uM [gamma-32P]ATP as co-substrate.
Residue:12
Sequence:
isvglagven vt