new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntestinal alkaline phosphatase
LigandBDBM76222
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS inhibitors of Mouse Intestinal Alkaline Phosphatase using Human Intestinal Alkaline Phosphatase
IC50 4610±n/a nM
Citation PubChem PC Dose Response confirmation of uHTS inhibitors of Mouse Intestinal Alkaline Phosphatase using Human Intestinal Alkaline Phosphatase PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Intestinal alkaline phosphatase
Name:Intestinal alkaline phosphatase
Synonyms:Alkaline phosphatase, intestinal
Type:PROTEIN
Mol. Mass.:56804.94
Organism:Homo sapiens (Human)
Description:ChEMBL_1278525
Residue:528
Sequence:
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM76222
n/a
NameBDBM76222
Synonyms:MLS001072174 | N-[3-(3-chlorophenyl)phenyl]-1-[(1-ethyl-3,5-dimethyl-4-pyrazolyl)methyl]-4-piperidinecarboxamide | N-[3-(3-chlorophenyl)phenyl]-1-[(1-ethyl-3,5-dimethyl-pyrazol-4-yl)methyl]isonipecotamide | N-[3-(3-chlorophenyl)phenyl]-1-[(1-ethyl-3,5-dimethyl-pyrazol-4-yl)methyl]piperidine-4-carboxamide | N-[3-(3-chlorophenyl)phenyl]-1-[(1-ethyl-3,5-dimethylpyrazol-4-yl)methyl]piperidine-4-carboxamide | SMR000654370 | cid_24816640
TypeSmall organic molecule
Emp. Form.C26H31ClN4O
Mol. Mass.451.004
SMILESCCn1nc(C)c(CN2CCC(CC2)C(=O)Nc2cccc(c2)-c2cccc(Cl)c2)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: