new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettyrosine-protein phosphatase non-receptor type 12 isoform 2
LigandBDBM46217
Substrate/Competitorn/a
Meas. Tech.SAR Selectivity Analysis of small molecule inhibitors of PEST using pCAP in a fluorescence assay
IC50 9450±n/a nM
Citation PubChem PC SAR Selectivity Analysis of small molecule inhibitors of PEST using pCAP in a fluorescence assay PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
tyrosine-protein phosphatase non-receptor type 12 isoform 2
Name:DNMT3A2/3L complex
Synonyms:DNA (cytosine-5)-methyltransferase 3A | DNA MTase HsaIIIA | DNA methyltransferase HsaIIIA | Dnmt3a | M.HsaIIIA
Type:PROTEIN
Mol. Mass.:101857.24
Organism:Homo sapiens (Human)
Description:ChEMBL_1510405
Residue:912
Sequence:
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV
ESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEG
AAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSL
RQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVE
EASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYN
KQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLV
YEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTIC
CGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRED
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRY
IASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPAR
KGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMI
DAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLKEYFACV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46217
n/a
NameBDBM46217
Synonyms:2-(2-dibenzothiophenyloxy)-2-methylpropanoic acid | 2-dibenzothiophen-2-yloxy-2-methyl-propanoic acid | 2-dibenzothiophen-2-yloxy-2-methyl-propionic acid | 2-dibenzothiophen-2-yloxy-2-methylpropanoic acid | MLS-0412044.0001 | cid_901652
TypeSmall organic molecule
Emp. Form.C16H14O3S
Mol. Mass.286.346
SMILESCC(C)(Oc1ccc2sc3ccccc3c2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: