Reaction Details |
| Report a problem with these data |
Target | Sentrin-specific protease 8 |
---|
Ligand | BDBM33185 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Luminescent Interference Counterscreen assay |
---|
IC50 | >5000±0 nM |
---|
Citation | PubChem, PC Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Luminescent Interference Counterscreen assay PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Sentrin-specific protease 8 |
---|
Name: | Sentrin-specific protease 8 |
Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 24104.52 |
Organism: | Homo sapiens (Human) |
Description: | gi_262118306 |
Residue: | 212 |
Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
BDBM33185 |
---|
n/a |
---|
Name | BDBM33185 |
Synonyms: | 4-({(4Z)-1-oxo-4-[(phenylsulfonyl)imino]-1,4-dihydronaphthalen-2-yl}amino)benzoic acid | 4-[(4-besylimino-1-keto-2-naphthyl)amino]benzoic acid | 4-[[(4Z)-4-besylimino-1-keto-2-naphthyl]amino]benzoic acid | 4-[[1-oxidanylidene-4-(phenylsulfonylimino)naphthalen-2-yl]amino]benzoic acid | 4-[[4-(benzenesulfonylimino)-1-oxo-2-naphthalenyl]amino]benzoic acid | 4-[[4-(benzenesulfonylimino)-1-oxonaphthalen-2-yl]amino]benzoic acid | MLS000686314 | SMR000313157 | cid_4053104 |
Type | Small organic molecule |
Emp. Form. | C23H16N2O5S |
Mol. Mass. | 432.449 |
SMILES | OC(=O)c1ccc(NC2=CC(=NS(=O)(=O)c3ccccc3)c3ccccc3C2=O)cc1 |w:11.11,t:8| |
Structure |
|