| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ubiquitin-conjugating enzyme E2 N |
|---|
| Ligand | BDBM51902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay |
|---|
| IC50 | 11817±247 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ubiquitin-conjugating enzyme E2 N |
|---|
| Name: | Ubiquitin-conjugating enzyme E2 N |
|---|
| Synonyms: | BLU | UBE2N | UBE2N_HUMAN | ubiquitin-conjugating enzyme E2 N |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17137.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_101440 |
|---|
| Residue: | 152 |
|---|
| Sequence: | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
|
|
|
|---|
| BDBM51902 |
|---|
| n/a |
|---|
| Name | BDBM51902 |
|---|
| Synonyms: | MLS001203758 | N-(4-Fluoro-benzylidene)-N'-(6-methoxy-2-methyl-quinolin-4-yl)-hydrazine | N-[(4-fluorophenyl)methylideneamino]-6-methoxy-2-methyl-4-quinolinamine | N-[(4-fluorophenyl)methylideneamino]-6-methoxy-2-methyl-quinolin-4-amine | N-[(4-fluorophenyl)methylideneamino]-6-methoxy-2-methylquinolin-4-amine | SMR000517671 | [(4-fluorobenzylidene)amino]-(6-methoxy-2-methyl-4-quinolyl)amine | [(E)-(4-fluorobenzylidene)amino]-(6-methoxy-2-methyl-4-quinolyl)amine | cid_3141521 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16FN3O |
|---|
| Mol. Mass. | 309.3375 |
|---|
| SMILES | COc1ccc2nc(C)cc(N=NCc3ccc(F)cc3)c2c1 |w:11.10| |
|---|
| Structure | 
|
|---|
Search and Browse
