| Reaction Details |
|---|
 | Report a problem with these data |
| Target | DNA damage-inducible transcript 3 protein |
|---|
| Ligand | BDBM63568 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | CHOP dose-response primary assay |
|---|
| IC50 | <160±n/a nM |
|---|
| Citation |  PubChem, PC CHOP dose-response primary assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| DNA damage-inducible transcript 3 protein |
|---|
| Name: | DNA damage-inducible transcript 3 protein |
|---|
| Synonyms: | Chop | Chop10 | DDIT3_MOUSE | Ddit3 | Gadd153 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19175.17 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | gi_160707929 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
|
|
|
|---|
| BDBM63568 |
|---|
| n/a |
|---|
| Name | BDBM63568 |
|---|
| Synonyms: | 2-({[2-(4-ethylphenyl)-5-methyl-1,3-oxazol-4-yl]methyl}thio)-N-(2-furylmethyl)acetamide | 2-[[2-(4-ethylphenyl)-5-methyl-1,3-oxazol-4-yl]methylsulfanyl]-N-(furan-2-ylmethyl)acetamide | 2-[[2-(4-ethylphenyl)-5-methyl-1,3-oxazol-4-yl]methylsulfanyl]-N-(furan-2-ylmethyl)ethanamide | 2-[[2-(4-ethylphenyl)-5-methyl-4-oxazolyl]methylthio]-N-(2-furanylmethyl)acetamide | 2-[[2-(4-ethylphenyl)-5-methyl-oxazol-4-yl]methylthio]-N-(2-furfuryl)acetamide | MLS000731007 | SMR000309382 | cid_16193680 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22N2O3S |
|---|
| Mol. Mass. | 370.465 |
|---|
| SMILES | CCc1ccc(cc1)-c1nc(CSCC(=O)NCc2ccco2)c(C)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
