| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tropomyosin alpha-1 chain |
|---|
| Ligand | BDBM79674 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF) |
|---|
| EC50 | 3911±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF) PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tropomyosin alpha-1 chain |
|---|
| Name: | Tropomyosin alpha-1 chain |
|---|
| Synonyms: | TPM1 | TPM1_PIG | cardiac alpha tropomyosin |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 32681.01 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | P42639 |
|---|
| Residue: | 284 |
|---|
| Sequence: | MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKY
SEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
|
|
|
|---|
| BDBM79674 |
|---|
| n/a |
|---|
| Name | BDBM79674 |
|---|
| Synonyms: | MLS000579105 | N'-[(3-oxo-1-benzothien-2(3H)-ylidene)methyl]benzohydrazide | N'-[(Z)-(3-ketobenzothiophen-2-ylidene)methyl]benzohydrazide | N'-[(Z)-(3-oxidanylidene-1-benzothiophen-2-ylidene)methyl]benzohydrazide | N'-[(Z)-(3-oxo-1-benzothiophen-2-ylidene)methyl]benzohydrazide | SMR000186694 | cid_5656784 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12N2O2S |
|---|
| Mol. Mass. | 296.344 |
|---|
| SMILES | Oc1c(C=NNC(=O)c2ccccc2)sc2ccccc12 |w:4.4| |
|---|
| Structure | 
|
|---|
Search and Browse
