| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tropomyosin alpha-1 chain |
|---|
| Ligand | BDBM50644 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF) |
|---|
| EC50 | 3934±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF) PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tropomyosin alpha-1 chain |
|---|
| Name: | Tropomyosin alpha-1 chain |
|---|
| Synonyms: | TPM1 | TPM1_PIG | cardiac alpha tropomyosin |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 32681.01 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | P42639 |
|---|
| Residue: | 284 |
|---|
| Sequence: | MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKY
SEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
|
|
|
|---|
| BDBM50644 |
|---|
| n/a |
|---|
| Name | BDBM50644 |
|---|
| Synonyms: | 7,9-bis(chloranyl)-4-[[(4-methoxyphenyl)amino]methylidene]-8-oxidanyl-1,2-dihydrodibenzofuran-3-one | 7,9-dichloro-8-hydroxy-4-(p-anisidinomethylene)-1,2-dihydrodibenzofuran-3-one | 7,9-dichloro-8-hydroxy-4-[(4-methoxyanilino)methylidene]-1,2-dihydrodibenzofuran-3-one | MLS000757138 | SMR000529015 | cid_342330 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H15Cl2NO4 |
|---|
| Mol. Mass. | 404.243 |
|---|
| SMILES | COc1ccc(NC=C2c3oc4cc(Cl)c(O)c(Cl)c4c3CCC2=O)cc1 |w:7.6| |
|---|
| Structure | 
|
|---|
Search and Browse
