new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA dC->dU-editing enzyme APOBEC-3G
LigandBDBM50041802
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of small molecule APOBEC3G DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
Temperature298.15±n/a K
IC50>100000±n/a nM
Commentsextracted
Citation PubChem PC Dose Response confirmation of small molecule APOBEC3G DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay PubChem Bioassay (2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
DNA dC->dU-editing enzyme APOBEC-3G
Name:DNA dC->dU-editing enzyme APOBEC-3G
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:46419.54
Organism:Homo sapiens (Human)
Description:gi_13399304
Residue:384
Sequence:
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYS
ELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFV
ARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPK
YYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRG
FLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS
KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQP
WDGLDEHSQDLSGRLRAILQNQEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041802
n/a
NameBDBM50041802
Synonyms:1,8-dihydroxy-9(10H)-anthracenone | 1,8-dihydroxy-9-anthrone | 1,8-dihydroxyanthracen-9(10H)-one | 1,8-dihydroxyanthrone | CHEMBL46469 | US9182402, 15 | anthralin | cid_2202 | dithranol
TypeSmall organic molecule
Emp. Form.C14H10O3
Mol. Mass.226.2274
SMILESOc1cccc2Cc3cccc(O)c3C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: