new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetprobable DNA dC->dU-editing enzyme APOBEC-3A
LigandBDBM38617
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of APOBEC3G DNA Deaminase Inhibitors via a A3A counterscreen
Temperature298.15±n/a K
IC50>100000±n/a nM
Commentsextracted
Citation PubChem PC Dose Response confirmation of APOBEC3G DNA Deaminase Inhibitors via a A3A counterscreen PubChem Bioassay (2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
probable DNA dC->dU-editing enzyme APOBEC-3A
Name:probable DNA dC->dU-editing enzyme APOBEC-3A
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:23013.77
Organism:Homo sapiens (Human)
Description:gi_21955158
Residue:199
Sequence:
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38617
n/a
NameBDBM38617
Synonyms:MLS000092916 | N-[2-(diethylamino)ethyl]-5-(4-keto-8-methoxy-2-thioxo-1,5-dihydropyrimid[5,4-b]indol-3-yl)valeramide | N-[2-(diethylamino)ethyl]-5-(8-methoxy-4-oxidanylidene-2-sulfanylidene-1,5-dihydropyrimido[5,4-b]indol-3-yl)pentanamide | N-[2-(diethylamino)ethyl]-5-(8-methoxy-4-oxo-2-sulfanylidene-1,5-dihydropyrimido[5,4-b]indol-3-yl)pentanamide | N-[2-(diethylamino)ethyl]-5-(8-methoxy-4-oxo-2-thioxo-1,2,4,5-tetrahydro-3H-pyrimido[5,4-b]indol-3-yl)pentanamide | SMR000028552 | cid_3244883
TypeSmall organic molecule
Emp. Form.C22H31N5O3S
Mol. Mass.445.578
SMILESCCN(CC)CCNC(=O)CCCCn1c(=S)[nH]c2c3cc(OC)ccc3[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: