| Reaction Details |
|---|
 | Report a problem with these data |
| Target | DNA dC->dU-editing enzyme APOBEC-3A |
|---|
| Ligand | BDBM80393 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 1060±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  PubChem, PC Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| DNA dC->dU-editing enzyme APOBEC-3A |
|---|
| Name: | DNA dC->dU-editing enzyme APOBEC-3A |
|---|
| Synonyms: | ABC3A_HUMAN | APOBEC3A | probable DNA dC->dU-editing enzyme APOBEC-3A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23013.77 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_21955158 |
|---|
| Residue: | 199 |
|---|
| Sequence: | MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
|
|
|
|---|
| BDBM80393 |
|---|
| n/a |
|---|
| Name | BDBM80393 |
|---|
| Synonyms: | MLS000552573 | SMR000146088 | Trimethyl-[2-(1-phenyl-cyclopentanecarbonyloxy)-ethyl]-ammonium | cid_9550116 | trimethyl-[2-(1-phenylcyclopentanecarbonyl)oxyethyl]ammonium;iodide | trimethyl-[2-(1-phenylcyclopentanecarbonyl)oxyethyl]azanium;iodide | trimethyl-[2-(1-phenylcyclopentyl)carbonyloxyethyl]azanium;iodide | trimethyl-[2-[oxo-(1-phenylcyclopentyl)methoxy]ethyl]ammonium;iodide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H26NO2 |
|---|
| Mol. Mass. | 276.3933 |
|---|
| SMILES | C[N+](C)(C)CCOC(=O)C1(CCCC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
