Reaction Details |
| Report a problem with these data |
Target | DNA dC->dU-editing enzyme APOBEC-3A |
---|
Ligand | BDBM80546 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 1890±n/a nM |
---|
Comments | extracted |
---|
Citation | PubChem, PC Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
DNA dC->dU-editing enzyme APOBEC-3A |
---|
Name: | DNA dC->dU-editing enzyme APOBEC-3A |
Synonyms: | ABC3A_HUMAN | APOBEC3A | probable DNA dC->dU-editing enzyme APOBEC-3A |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 23013.77 |
Organism: | Homo sapiens (Human) |
Description: | gi_21955158 |
Residue: | 199 |
Sequence: | MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
|
|
|
BDBM80546 |
---|
n/a |
---|
Name | BDBM80546 |
Synonyms: | 1-{2-[(5-Dimethylsulfamoyl-furan-2-carbonyl)-amino]-ethyl}-1-methyl-azepanium | 5-(dimethylsulfamoyl)-N-[2-(1-methyl-1-azepan-1-iumyl)ethyl]-2-furancarboxamide;iodide | 5-(dimethylsulfamoyl)-N-[2-(1-methylazepan-1-ium-1-yl)ethyl]-2-furamide;iodide | 5-(dimethylsulfamoyl)-N-[2-(1-methylazepan-1-ium-1-yl)ethyl]furan-2-carboxamide;iodide | MLS001212477 | SMR000518608 | cid_24747087 |
Type | Small organic molecule |
Emp. Form. | C16H28N3O4S |
Mol. Mass. | 358.476 |
SMILES | CN(C)S(=O)(=O)c1ccc(o1)C(=O)NCC[N+]1(C)CCCCCC1 |
Structure |
|