| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nicotinate-nucleotide adenylyltransferase |
|---|
| Ligand | BDBM50318653 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzymatic Inhibition Assay |
|---|
| Ki | 2.5e+4± 9e+3 nM |
|---|
| IC50 | 6.5e+4±n/a nM |
|---|
| Citation |  Sorci, L; Pan, Y; Eyobo, Y; Rodionova, I; Huang, N; Kurnasov, O; Zhong, S; MacKerell, AD; Zhang, H; Osterman, AL Targeting NAD biosynthesis in bacterial pathogens: Structure-based development of inhibitors of nicotinate mononucleotide adenylyltransferase NadD. Chem Biol16:849-61 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nicotinate-nucleotide adenylyltransferase |
|---|
| Name: | Nicotinate-nucleotide adenylyltransferase |
|---|
| Synonyms: | Deamido-NAD(+) pyrophosphorylase | NADD_ECOLI | Nicotinate mononucleotide adenylyltransferase (NadD) | Nicotinate-nucleotide adenylyltransferase (NadD) | nadD | ybeN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 24523.61 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | P0A752 |
|---|
| Residue: | 213 |
|---|
| Sequence: | MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHML
ELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEY
ETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNIS
ATIIRERLQNGESCEDLLPEPVLTYINQQGLYR
|
|
|
|---|
| BDBM50318653 |
|---|
| n/a |
|---|
| Name | BDBM50318653 |
|---|
| Synonyms: | 3-amino-N-(3-fluorophenyl)-6-(thiophen-2-yl)thieno[2,3-b]pyridine-2-carboxamide | 3-amino-N-(3-fluorophenyl)-6-thiophen-2-ylthieno[2,3-b]pyridine-2-carboxamide | CHEMBL1084955 | NadD inhibitor 3_02 | US8785499, 3_02 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H12FN3OS2 |
|---|
| Mol. Mass. | 369.436 |
|---|
| SMILES | Nc1c(sc2nc(ccc12)-c1cccs1)C(=O)Nc1cccc(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
