Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 4
LigandBDBM8061
Substrate/Competitorn/a
Meas. Tech.In Vitro Kinase Assay
Ki 19±17 nM
Citation Wang SGriffiths GMidgley CABarnett ALCooper MGrabarek JIngram LJackson WKontopidis GMcClue SJMcInnes CMcLachlan JMeades CMezna MStuart IThomas MPZheleva DILane DPJackson RCGlover DMBlake DGFischer PM Discovery and characterization of 2-anilino-4- (thiazol-5-yl)pyrimidine transcriptional CDK inhibitors as anticancer agents. Chem Biol 17:1111-21 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 4
Name:CDK4/CDK9
Synonyms:CDK4 | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3
Type:Enzyme Subunit
Mol. Mass.:33731.96
Organism:Homo sapiens (Human)
Description:P11802
Residue:303
Sequence:
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8061
n/a
NameBDBM8061
Synonyms:2-Anilino-4-(thiazol-5-yl)pyrimidine deriv. 32 | 4-(2-amino-4-methyl-1,3-thiazol-5-yl)-N-(3-nitrophenyl)pyrimidin-2-amine, 4 | 4-methyl-5-{2-[(3-nitrophenyl)amino]pyrimidin-4-yl}-1,3-thiazol-2-amine | CDK Inhibitor, 1 | [4-(2-Amino-4-methylthiazol-5-yl)pyrimidin-2-yl](3-nitrophenyl)amine
TypeSmall organic molecule
Emp. Form.C14H12N6O2S
Mol. Mass.328.349
SMILESCc1nc(N)sc1-c1ccnc(Nc2cccc(c2)N(=O)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: