Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM10758
Substrate/Competitorn/a
Ki 2100±n/a nM
CommentsPDSP_20666
Citation U'Prichard DCGreenberg DASnyder SH Binding characteristics of a radiolabeled agonist and antagonist at central nervous system alpha noradrenergic receptors. Mol Pharmacol 13:454-73 (1977) [PubMed]
More Info.:Get all data from this article
 
Alpha-1A adrenergic receptor
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Adrenaline | Adrenaline 1 | Alpha-1 adrenoreceptor | adrenergic Alpha1A
Type:Protein
Mol. Mass.:51620.15
Organism:Rattus norvegicus (Rat)
Description:P43140
Residue:466
Sequence:
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10758
n/a
NameBDBM10758
Synonyms:14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine
TypeSmall organic molecule
Emp. Form.C8H11N
Mol. Mass.121.1796
SMILESNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: