Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM22888
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_445
Citation Tran VTChang RSSnyder SH Histamine H1 receptors identified in mammalian brain membranes with [3H]mepyramine. Proc Natl Acad Sci U S A 75:6290-4 (1978) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:Enzyme Catalytic Domain
Mol. Mass.:55716.35
Organism:RAT
Description:HISTAMINE H1 HRH1 RAT::P31390
Residue:486
Sequence:
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFSFLWVIPILGWHHFMPPAPELREDKC
ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPSFSELKLR
SDDTKEGAKKPGRESPWGVLKRPSRDPSVGLDQKSTSEDPKMTSPTVFSQEGERETRPCF
RLDIMQKQSVAEGDVRGSKANDQALSQPKMDEQSLNTCRRISETSEDQTLVDQQSFSRTT
DSDTSIEPGPGRVKSRSGSNSGLDYIKITWKRLRSHSRQYVSGLHLNRERKAAKQLGFIM
AAFILCWIPYFIFFMVIAFCKSCCSEPMHMFTIWLGYINSTLNPLIYPLCNENFKKTFKK
ILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22888
n/a
NameBDBM22888
Synonyms:1-[4-(1H-imidazol-5-yl)butyl]-3-methylthiourea | Burimamide | CHEMBL12160
TypeSmall organic molecule
Emp. Form.C9H16N4S
Mol. Mass.212.315
SMILESCNC(=S)NCCCCc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: