Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50079527
Substrate/Competitorn/a
Ki 0.7±n/a nM
CommentsPDSP_735
Citation Tran VTChang RSSnyder SH Histamine H1 receptors identified in mammalian brain membranes with [3H]mepyramine. Proc Natl Acad Sci U S A 75:6290-4 (1978) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:Enzyme Catalytic Domain
Mol. Mass.:55716.35
Organism:RAT
Description:HISTAMINE H1 HRH1 RAT::P31390
Residue:486
Sequence:
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFSFLWVIPILGWHHFMPPAPELREDKC
ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPSFSELKLR
SDDTKEGAKKPGRESPWGVLKRPSRDPSVGLDQKSTSEDPKMTSPTVFSQEGERETRPCF
RLDIMQKQSVAEGDVRGSKANDQALSQPKMDEQSLNTCRRISETSEDQTLVDQQSFSRTT
DSDTSIEPGPGRVKSRSGSNSGLDYIKITWKRLRSHSRQYVSGLHLNRERKAAKQLGFIM
AAFILCWIPYFIFFMVIAFCKSCCSEPMHMFTIWLGYINSTLNPLIYPLCNENFKKTFKK
ILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079527
n/a
NameBDBM50079527
Synonyms:(3E)-3-dibenzo[b,e]oxepin-11(6H)-ylidene-N,N-dimethylpropan-1-amine(3Z)-3-dibenzo[b,e]oxepin-11(6H)-ylidene-N,N-dimethylpropan-1-amine | CHEMBL101740 | DOXEPIN | cis-doxepin
TypeSmall organic molecule
Emp. Form.C19H21NO
Mol. Mass.279.3761
SMILESCN(C)CC\C=C1\c2ccccc2COc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: